pECFP-mCerulean plasmid for mammalian expression of Cerulean kanamycin resistant

Availability:

20 in stock


Compare

This is the plasmid DNA for enhanced CFP expression in mammalian cells. The DNA will be provided dry on a small piece filter paper. DNA can be eluted from the paper using distilled water.

$1.00

20 in stock

  Ask a Question

Sequence
Protein
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRA
EVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK*

cDNA
ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGAT
GCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTGGGGCGTGCAGTGCTTCGCCCGC
TACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCC
GAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACGCCATCAGC
GACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAAGGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAG
AACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTG
GAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA

Category: Tags:

Based on 0 reviews

0.0 overall
0
0
0
0
0

Be the first to review “pECFP-mCerulean plasmid for mammalian expression of Cerulean kanamycin resistant”

There are no reviews yet.

No more offers for this product!

Shipping Policy

Provider will choose different class of shipping and handling based on the products for shipping. Each shipping class will charge differently.

Refund Policy

We will not encourage any refund because of the nature of products provided. All the products shared by the fellow scientists are most recent invention and findings and still at the stage of trial and error. However, you may provide objective review and feedback for the products to help others.

Cancellation / Return / Exchange Policy

The request only can be canceled before shipping. Once the products are prepared and shipped no cancellation is allowed. Given the nature of all the products shared by fellow scientists, no return will be granted. However you may contact the provider to negotiate a second sample for testing and leave feedback to the products to help others avoid pitfalls.

General Inquiries

There are no inquiries yet.